PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.07G122100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 438aa    MW: 49317.7 Da    PI: 7.4785
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.07G122100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.66.5e-112522901854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          lFe   ++yps +e++ LA+++gL+ +qV++WF N R +
  Manes.07G122100.1.p 252 LFEHflHPYPSDSEKQILAQQTGLSRTQVSNWFINARVR 290
                          5775569******************************88 PP

2BELL941.4e-30122191372
                 BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           e++ k +kL+ +l+eV++rYk y++q+q  ++sFe+vaglg+a+pY+  A k+iS+hF cLk+a+ +qi
  Manes.07G122100.1.p 122 IEHRWKNSKLILMLDEVYRRYKLYCQQMQSAVASFETVAGLGHAAPYICYAIKTISKHFTCLKNALLDQI 191
                          78999**************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.9E-3467189IPR006563POX domain
PfamPF075261.3E-3072187IPR006563POX domain
PROSITE profilePS5007112.6231294IPR001356Homeobox domain
SMARTSM003896.5E-13234298IPR001356Homeobox domain
CDDcd000869.62E-14234295No hitNo description
Gene3DG3DSA:1.10.10.602.0E-28237298IPR009057Homeodomain-like
SuperFamilySSF466898.55E-19237303IPR009057Homeodomain-like
PfamPF059201.9E-18251290IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MNPSPSPPFS SLQNPKDHHL MSYHPQGLSL SLSFQLDSQR CNAVSVYGDF LKQNGEITSS  60
FPLGPFTGYA TILKSSRFLK PAQQILDDLC GTANYEVLNL SLDFLNESEV IMRESVAFAD  120
HIEHRWKNSK LILMLDEVYR RYKLYCQQMQ SAVASFETVA GLGHAAPYIC YAIKTISKHF  180
TCLKNALLDQ IHFTCKTSDD GNIISGERIP RFWAADEQNQ NQSLNISFLQ HPVWRSQRGL  240
PDHAVAVLKK WLFEHFLHPY PSDSEKQILA QQTGLSRTQV SNWFINARVR LWKPMVEEVY  300
KLASQQAQSP LEAVNHNPSF LLPDFSAENL SQIQTTQPQK PDDIQAKRSR NQELADISMQ  360
RRDLRNAFNN SSSHYQAAVN GSNGVSLALG LHQNIGIDLS RSVPMNLAHH VNLEMISMMD  420
SASAASLQAQ NQQFGKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16240298563Homeobox protein Meis2
3k2a_B5e-16240298563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002524245.20.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLB9SE260.0B9SE26_RICCO; Bel1 homeotic protein, putative
STRINGPOPTR_0008s06130.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-75TALE family protein